General Information

  • ID:  hor007052
  • Uniprot ID:  P48800??14-158)
  • Protein name:  Fibroblast growth factor 2
  • Gene name:  Reg2
  • Organism:  Gallus gallus
  • Family:  Heparin-binding growth factors family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken)
  • GO MF:  GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005615 extracellular space; GO:0005730 nucleolus; GO:0005634 nucleus
  • GO BP:  GO:0008201 heparin binding; GO:0005178 integrin binding; GO:0005104 fibroblast growth factor receptor binding; GO:0008083 growth factor activity
  • GO CC:  GO:0002089 lens morphogenesis in camera-type eye; GO:0022008 neurogenesis; GO:0045766 positive regulation of angiogenesis; GO:0043536 positive regulation of blood vessel endothelial cell migration; GO:0051781 positive regulation of cell division; GO:0090050 positive regulation of cell migration involved in sprouting angiogenesis; GO:0010756 positive regulation of plasminogen activation; GO:0010628 positive regulation of gene expression; GO:0060563 neuroepithelial cell differentiation; GO:0030334 regulation of cell migration; GO:0072089 stem cell proliferation; GO:0001894 tissue homeostasis; GO:0042060 wound healing; GO:0008284 positive regulation of cell population proliferation; GO:0003407 neural retina development; GO:0003347 epicardial cell to mesenchymal cell transition; GO:0001707 mesoderm formation; GO:0070660 inner ear receptor cell differentiation involved in inner ear sensory epithelium regeneration; GO:0014843 growth factor dependent regulation of skeletal muscle satellite ce

Sequence Information

  • Sequence:  ALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS
  • Length:  145
  • Propeptide:  MAAGAAGSITTLPALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA